PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G145300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 30118.8 Da    PI: 8.6901
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G145300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.22.2e-28959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+i+n + rqvtfskRr g++KKAeELSvLCdaeva+iifs tgkl+ey+s
  Manes.02G145300.1.p  9 KKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEYCS 59
                         68***********************************************96 PP

2K-box44.28.3e-16911711999
                K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                           + a L+kei +  +++R+++Ge+L+ L+++eLqqLe+ Le +l+++ ++K + ++++i  l kk  +l eenk+L++k++
  Manes.02G145300.1.p  91 SHRAHLNKEIAEKTQQLRQMMGENLQGLDIEELQQLEKLLEAGLSRVLETKGDKMMNEILMLEKKGAQLLEENKQLKEKMM 171
                          55678999999999999*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.899161IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-31374IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.6E-251057IPR002100Transcription factor, MADS-box
CDDcd002651.22E-331275No hitNo description
PRINTSPR004047.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.83886177IPR002487Transcription factor, K-box
PfamPF014862.0E-1594170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MAREKIKIKK IDNITARQVT FSKRRRGLFK KAEELSVLCD AEVALIIFSA TGKLFEYCSS  60
STKDVIARYN LHSNNLDKLE RPSLELELEN SHRAHLNKEI AEKTQQLRQM MGENLQGLDI  120
EELQQLEKLL EAGLSRVLET KGDKMMNEIL MLEKKGAQLL EENKQLKEKM MRILSKGKGP  180
ALLEWDGGIH QEEGMSSESA TNFCSYPTGP PLPLADDSYY TSLKLGKHGS KSNKFSLNFS  240
LKRAAIYLLL SVNCFAGCPF EDGGKTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-18180186Myocyte-specific enhancer factor 2B
1tqe_R7e-18180186Myocyte-specific enhancer factor 2B
1tqe_Q7e-18180186Myocyte-specific enhancer factor 2B
1tqe_P7e-18180186Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011016930.11e-114PREDICTED: MADS-box protein JOINTLESS
SwissprotQ9FUY63e-88JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLQ6RF311e-113Q6RF31_POPTO; MADS box transcription factor
STRINGVIT_18s0001g07460.t011e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89033106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.15e-81MIKC_MADS family protein