PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G100400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 26569.1 Da    PI: 8.6268
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G100400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.91.6e-29959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien +nrqvt+skRrngi+KKA+EL vLCda+v++i+fs+tgk++e++s
  Manes.02G100400.1.p  9 KRIENATNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEFIS 59
                         79***********************************************86 PP

2K-box89.94.8e-3071168198
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          yq++ g +l+++++e++q++l+kL++ +++L+r +R+++GedL++Ls+ eL  Leq+++++l+ iR++K++++++q+e+ +kk k+l+e+
  Manes.02G100400.1.p  71 YQETLGIDLWKTHYERMQEHLRKLREINNKLRRDIRQRMGEDLDDLSMDELFVLEQRMDSALELIRDRKYHVIKTQTETCKKKVKNLEER 160
                          78888999********************************************************************************** PP

                K-box  91 nkaLrkkl 98 
                          + +L  ++
  Manes.02G100400.1.p 161 HGDLLLEY 168
                          *9997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.716161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-37294IPR002100Transcription factor, MADS-box
CDDcd002651.57E-39280No hitNo description
PRINTSPR004043.6E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.9E-2082165IPR002487Transcription factor, K-box
PROSITE profilePS5129715.80784174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT YSKRRNGIFK KAQELTVLCD AKVSLIMFSN TGKFHEFISP  60
TTTTKKVFDQ YQETLGIDLW KTHYERMQEH LRKLREINNK LRRDIRQRMG EDLDDLSMDE  120
LFVLEQRMDS ALELIRDRKY HVIKTQTETC KKKVKNLEER HGDLLLEYEA KYEDPQYGLV  180
ENEGDYESAI ALANGASNLY AFRLHHGHPP TNFHHGGGFG SHDLRLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-14273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-14273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-14273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-14273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-14273170Myocyte-specific enhancer factor 2A
3p57_I2e-14273170Myocyte-specific enhancer factor 2A
3p57_D2e-14273170Myocyte-specific enhancer factor 2A
3p57_C2e-14273170Myocyte-specific enhancer factor 2A
3p57_B2e-14273170Myocyte-specific enhancer factor 2A
3p57_A2e-14273170Myocyte-specific enhancer factor 2A
3kov_J2e-14273170Myocyte-specific enhancer factor 2A
3kov_I2e-14273170Myocyte-specific enhancer factor 2A
3kov_B2e-14273170Myocyte-specific enhancer factor 2A
3kov_A2e-14273170Myocyte-specific enhancer factor 2A
1tqe_S2e-14173171Myocyte-specific enhancer factor 2B
1tqe_R2e-14173171Myocyte-specific enhancer factor 2B
1tqe_Q2e-14173171Myocyte-specific enhancer factor 2B
1tqe_P2e-14173171Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078388.11e-138PREDICTED: floral homeotic protein DEFICIENS-like
SwissprotP237061e-101DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLQ003J21e-136Q003J2_VITVI; Flowering-related B-class MADS-box protein
STRINGVIT_04s0023g02820.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27353375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.15e-80MIKC_MADS family protein