PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G100100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SRS
Protein Properties Length: 333aa    MW: 35513.3 Da    PI: 6.9096
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G100100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702218.21.8e-671102545154
               DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssa 94 
                          ++sCqdCGnqakkdC h+RCRtCC+srg+dC thvkstWvpa+krrerqqql+a+++++    + +++kr  e+    +s+l++ +l+++
  Manes.02G100100.1.p 110 GVSCQDCGNQAKKDCIHMRCRTCCRSRGLDCPTHVKSTWVPASKRRERQQQLNALQQQQL---RGENPKRLSEN--PCSSSLACIRLPNS 194
                          579**************************************************9977664...45555555544..678999******** PP

               DUF702  95 eskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                           s   le  ++P+evss+avfrcvrvs+++++++++aYqtav+igGh+fkGiLyd+G+e+
  Manes.02G100100.1.p 195 ASDAGLELGNFPAEVSSPAVFRCVRVSGMEKDDDQYAYQTAVNIGGHLFKGILYDHGPES 254
                          **********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.3E-63110253IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.4E-27112154IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.0E-26205252IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAGLFSLGGG SGGGGGGGRG SNQDDQHDHP PTEIPQESWY WYKNEDIPYK GFELWQQQEF  60
LYQRHQNPQQ HLYSSAAGLG VGPSRSSINV SDESSSRSAF MMMRSSSGVG VSCQDCGNQA  120
KKDCIHMRCR TCCRSRGLDC PTHVKSTWVP ASKRRERQQQ LNALQQQQLR GENPKRLSEN  180
PCSSSLACIR LPNSASDAGL ELGNFPAEVS SPAVFRCVRV SGMEKDDDQY AYQTAVNIGG  240
HLFKGILYDH GPESTYMPAT ETSSADASGG VQQLNLITAA TASAVISPTG GGGGITSASS  300
SAAAAFIDPS SLYPTPLNTY IAGTPFFPNP RS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.02G100100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021602481.10.0protein SHI RELATED SEQUENCE 1 isoform X1
SwissprotQ9SD401e-99SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A2C9WCY10.0A0A2C9WCY1_MANES; Uncharacterized protein
STRINGcassava4.1_034312m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.13e-80Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]