PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G085500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28453.1 Da    PI: 9.8364
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G085500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.31.6e-312877150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  Manes.02G085500.1.p 28 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 77
                         79***********************************************8 PP

2K-box110.91.3e-36961924100
                K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                          s+  s++ea+++ +qqe++kL+++i+++q+ +Rh+lGe L++L++keL++Le +Lek++++iRskKne+l+++ie++qk+e elq++n++
  Manes.02G085500.1.p  96 SNPASASEANTQFYQQESSKLRRQIREIQNLNRHILGEALSTLTFKELKNLEGRLEKGISRIRSKKNEMLFAEIEYMQKREIELQNDNMY 185
                          3444599*********************************************************************************** PP

                K-box  94 Lrkklee 100
                          Lr+k++e
  Manes.02G085500.1.p 186 LRAKIAE 192
                          ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.3752080IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-412079IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-332193IPR002100Transcription factor, MADS-box
CDDcd002651.02E-452197No hitNo description
PROSITE patternPS0035002276IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-332242IPR002100Transcription factor, MADS-box
PfamPF003199.3E-272976IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-334257IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-335778IPR002100Transcription factor, MADS-box
PfamPF014863.3E-26103190IPR002487Transcription factor, K-box
PROSITE profilePS5129715.128106196IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
IATTEFPNQE PDQGPSLRKT GRGKIEIKRI ENTTNRQVTF CKRRNGLLKK AYELSVLCDA  60
EVALIVFSSR GRLYEYANNS VRATIDRYKK ASADSSNPAS ASEANTQFYQ QESSKLRRQI  120
REIQNLNRHI LGEALSTLTF KELKNLEGRL EKGISRIRSK KNEMLFAEIE YMQKREIELQ  180
NDNMYLRAKI AENERAQQQQ QQTSLMPGGS VYESVPSQAY DRNFIPVNLL EPNHHYSRPD  240
HTALQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-202192273Myocyte-specific enhancer factor 2B
1tqe_R2e-202192273Myocyte-specific enhancer factor 2B
1tqe_Q2e-202192273Myocyte-specific enhancer factor 2B
1tqe_P2e-202192273Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066543.11e-159PREDICTED: agamous-like MADS-box protein AGL1
SwissprotP293811e-126AGL1_ARATH; Agamous-like MADS-box protein AGL1
TrEMBLG8FUQ31e-148G8FUQ3_MANIN; AGAMOUS-like protein
STRINGVIT_12s0142g00360.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68429102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.11e-117MIKC_MADS family protein