PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G059300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28531.5 Da    PI: 9.1569
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G059300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.32.7e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs +gkl+eys+
  Manes.02G059300.1.p  9 KRIENKINRQVTFSKRRTGLLKKAHEISVLCDAEVALIVFSIKGKLFEYST 59
                         79***********************************************96 PP

2K-box97.42.1e-32801738100
                K-box   8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                          + ++++++ +++ e  kL ++ie L+r++R++ GedL+++sl+eLq+Leqq+ ++lk++R++Kn+l++e+i+ lqkke++l+e+n++L+k
  Manes.02G059300.1.p  80 AaNDSEHQGNWSLECPKLMARIEILERSLRNFSGEDLDPMSLRELQHLEQQIANGLKRVRARKNQLYHESISGLQKKERALHEQNNMLSK 169
                          336788899********************************************************************************* PP

                K-box  97 klee 100
                          kl+e
  Manes.02G059300.1.p 170 KLKE 173
                          *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.043161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-32285IPR002100Transcription factor, MADS-box
CDDcd002652.02E-41279No hitNo description
PRINTSPR004049.7E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014867.1E-2783171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.92387177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRTGLLK KAHEISVLCD AEVALIVFSI KGKLFEYSTN  60
SSMERILERY ESYSSAERQA ANDSEHQGNW SLECPKLMAR IEILERSLRN FSGEDLDPMS  120
LRELQHLEQQ IANGLKRVRA RKNQLYHESI SGLQKKERAL HEQNNMLSKK LKENEKTTAE  180
QANCEQQNLG PNPTSFMPPP ILSLPSLSIS ASGPLQTREF MNENEEARAQ IHPDTLQIPP  240
WMLRHVNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-22174173Myocyte-specific enhancer factor 2B
1tqe_R3e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q3e-22174173Myocyte-specific enhancer factor 2B
1tqe_P3e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525917.21e-128PREDICTED: truncated transcription factor CAULIFLOWER A isoform X1
SwissprotQ424293e-92AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A061EHA91e-114A0A061EHA9_THECC; Agamous-like MADS-box protein AGL8 isoform 1
STRINGVIT_01s0011g00100.t012e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.15e-83AGAMOUS-like 8