PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.02G031200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRF
Protein Properties Length: 192aa    MW: 20990.8 Da    PI: 9.3453
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.02G031200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.85.9e-26116160145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          d+epgrCrRtDGKkWRCs+++l+++k+CErH+hrgr+rsrk +e+
  Manes.02G031200.1.p 116 DPEPGRCRRTDGKKWRCSKEALPDQKYCERHMHRGRQRSRKLVEA 160
                          79***************************************9986 PP

2QLQ32.52.6e-124478337
                  QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                         FT  Qlq+L  Q l+yKy+ ++  vP +L+++++k
  Manes.02G031200.1.p 44 FTILQLQELQLQSLIYKYIESGFSVPYHLVLPLWK 78
                         7888*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5166616.4284378IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.2E-94477IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.77116160IPR014977WRC domain
PfamPF088794.4E-22117159IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MERHGYNGGS AGSPPIGLGL ALGRGGSTDH RPMPIPACTG SYGFTILQLQ ELQLQSLIYK  60
YIESGFSVPY HLVLPLWKSV PSSLSGSNSK LYQPYPSSMG GSNSIPLHLE YKIGMDPEPG  120
RCRRTDGKKW RCSKEALPDQ KYCERHMHRG RQRSRKLVEA NSETLNASTN LSISLPFSND  180
DPSTGEVGLR P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298083.24e-77hypothetical protein POPTR_0001s08310g
SwissprotQ6EPP91e-39GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLB9GKS44e-77B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.11e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.16e-29growth-regulating factor 2