PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G263500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 24844.6 Da    PI: 9.8697
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G263500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.69.4e-30958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fss gklye++
  Manes.01G263500.1.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSSGGKLYEFA 58
                         79***********************************************8 PP

2K-box85.98.4e-2981171797
                K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                          k  +e+ +++l+ e++++ k+ie L+ ++R+l+Ge+L+s++++eLqqLeqqLeks+++iR++Kn++++eqie+l++kek l  en +L++
  Manes.01G263500.1.p  81 KTFDENMQQQLKSEATNMVKKIELLEISKRKLMGEGLGSCTVEELQQLEQQLEKSVSTIRARKNQVFREQIERLKEKEKLLAAENAKLSE 170
                          337788899*******************************************************************************99 PP

                K-box  97 k 97 
                          k
  Manes.01G263500.1.p 171 K 171
                          8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.244161IPR002100Transcription factor, MADS-box
CDDcd002651.79E-40372No hitNo description
SuperFamilySSF554551.31E-32381IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2884172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.21888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSS GGKLYEFANC  60
SMQETIARYH KHVKATQINK KTFDENMQQQ LKSEATNMVK KIELLEISKR KLMGEGLGSC  120
TVEELQQLEQ QLEKSVSTIR ARKNQVFREQ IERLKEKEKL LAAENAKLSE KCGGQPCQGL  180
KLVGETRHCE ESSQVSDVET ELFIGPPETR NKRNPPRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-19372271Myocyte-specific enhancer factor 2A
3kov_B1e-19372271Myocyte-specific enhancer factor 2A
3kov_I1e-19372271Myocyte-specific enhancer factor 2A
3kov_J1e-19372271Myocyte-specific enhancer factor 2A
3p57_A1e-19372271Myocyte-specific enhancer factor 2A
3p57_B1e-19372271Myocyte-specific enhancer factor 2A
3p57_C1e-19372271Myocyte-specific enhancer factor 2A
3p57_D1e-19372271Myocyte-specific enhancer factor 2A
3p57_I1e-19372271Myocyte-specific enhancer factor 2A
3p57_J1e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1429140.0GU142914.1 Hevea brasiliensis MADS-box transcription factor 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511767.21e-120PREDICTED: MADS-box protein SOC1 isoform X1
RefseqXP_015584388.11e-120PREDICTED: MADS-box protein SOC1 isoform X1
RefseqXP_015584389.11e-120PREDICTED: MADS-box protein SOC1 isoform X1
SwissprotO646452e-86SOC1_ARATH; MADS-box protein SOC1
TrEMBLD1MFS71e-126D1MFS7_HEVBR; MADS-box transcription factor 2
STRINGGLYMA18G45780.11e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66630102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-78AGAMOUS-like 20