PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G261300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HD-ZIP
Protein Properties Length: 819aa    MW: 89101.1 Da    PI: 6.084
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G261300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.9e-21116171156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  Manes.01G261300.1.p 116 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 171
                          688999***********************************************999 PP

2START205.91.6e-643225461206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela++a++elvk+a+ +ep+W++s     e +n +e++++f++  +     + +ea+r++g+v+ +   lve+l+d++ +W e+++    
  Manes.01G261300.1.p 322 ELALAAMDELVKLAQTDEPLWFRSLeggrEVLNHEEYMRIFTPCIGmkpsgFVSEASRETGMVIINGLALVETLMDSN-RWAEMFPcmia 410
                          5899************************9*************999899******************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          + +t++vis+g      g lqlm aelqalsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  + +v +++lpSg+++++++ng
  Manes.01G261300.1.p 411 RTSTTDVISTGmggtrnGSLQLMHAELQALSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPTFVNCRRLPSGCVVQDMPNG 500
                          *****************************************************************999********************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +skvtwveh+++++ ++h+l+r+l++sg+ +ga++wvatlqrqce+
  Manes.01G261300.1.p 501 YSKVTWVEHAEYDETQIHQLYRPLISSGMGFGAQRWVATLQRQCEC 546
                          ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.15E-20101173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-21102167IPR009057Homeodomain-like
PROSITE profilePS5007117.41113173IPR001356Homeobox domain
SMARTSM003891.7E-17114177IPR001356Homeobox domain
CDDcd000862.02E-18115173No hitNo description
PfamPF000462.2E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084844.598313549IPR002913START domain
SuperFamilySSF559616.04E-33315546No hitNo description
CDDcd088752.58E-127317545No hitNo description
PfamPF018521.5E-56322546IPR002913START domain
SMARTSM002341.5E-48322546IPR002913START domain
SuperFamilySSF559611.88E-23567745No hitNo description
SuperFamilySSF559611.88E-23772804No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MSFGGFLENG SPGGGGARIV ADIAYSSSSM PAGAIAQPRL ISHSLTKSMF NSPGLSLALQ  60
QPNIDGQGDV PRMVENFEPN GARRSREEEH ESRSGSDNLD GASGDDQDAA DNRPRKKRYH  120
RHTPQQIQEL EALFKECPHP DEKQRLELSR RLCLETRQVK FWFQNRRTQM KTQLERHENT  180
LLRQENDKLR AENMSIRDAM RNPICSNCGG PAIIGDISLE EQHLTIENAR LKEELDRVCA  240
LAGKFLGRPI SLLANSIGPP MPNSSLELGV GNNGFGCLSN AAATVPLGPD FSNALPVVTQ  300
TRPPTASMTG FDRSLERSMF LELALAAMDE LVKLAQTDEP LWFRSLEGGR EVLNHEEYMR  360
IFTPCIGMKP SGFVSEASRE TGMVIINGLA LVETLMDSNR WAEMFPCMIA RTSTTDVIST  420
GMGGTRNGSL QLMHAELQAL SPLVPVREVN FLRFCKQHAE GVWAVVDVSI DTIRETSGAP  480
TFVNCRRLPS GCVVQDMPNG YSKVTWVEHA EYDETQIHQL YRPLISSGMG FGAQRWVATL  540
QRQCECLAIL MSSTVPTRDH TAITSSGRRS MLKLAQRMTD NFCAGVCAST VHKWNKLNAG  600
NVDEDVRVMT RKSVDDPGEP PGIVLSAATS VWLPVSPQRL FDFLRDERLR SEWDILSNGG  660
PMQEMAHIAK GQDQGNCVSL LRASAMNANQ SSMLILQETC IDAAGSLVVY APVDIPAMHV  720
VMNGGDSAYV ALLPSGFAIV PDGPGSRGSP GTANDPTSNN GGGPGGQHRV SGSLLTVAFQ  780
ILVNSLPTAK LTVESVETVN NLISCTVQKI KAALQCES*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.01G261300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021613538.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2C9WP550.0A0A2C9WP55_MANES; Uncharacterized protein
STRINGcassava4.1_001772m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]