PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G253000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 358aa    MW: 39293.2 Da    PI: 9.8729
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G253000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.8e-1381125147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Manes.01G253000.1.p  81 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 125
                          789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-1675131IPR009057Homeodomain-like
PROSITE profilePS5129415.40876130IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-679131IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-1879128IPR006447Myb domain, plants
SMARTSM007175.3E-1180128IPR001005SANT/Myb domain
PfamPF002493.1E-1181125IPR001005SANT/Myb domain
CDDcd001672.41E-883126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MVSVNPNPAQ EFYFLDPMNM GLPGLNSLPP QMTSNTLSTN TTSTATNTTS ASTTSAGANT  60
VAFADDPSKK IRKPYTITKS RESWTEQEHD KFLEALQLFD RDWKKIEAFV GSKTVIQIRS  120
HAQKYFLKVQ KSGTSEHVPP PRPKRKAAHP YPQKAPKNAA PVVTQVPGSF QSSSASLEPG  180
YAYRSDALSV PGNPVAGGTV TTWSFNSVPA VNVSQVTKDD MRLAQQKIAN NCYSSSNEST  240
PRAWQTSEII DRGDQGKPKR VVPDFAQVYS FIGSVFDPSA TGHLQRLKQM DPINLETVLL  300
LMRNLSVNLV SPEFEDHRRL LVSYDTESER VKSVSPYSNV GVDRTRDILS APKAVRG*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.01G253000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU9477693e-80KU947769.1 Toxicodendron vernicifluum microsatellite c26331 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021612539.10.0protein REVEILLE 6-like isoform X2
SwissprotC0SVG51e-110RVE5_ARATH; Protein REVEILLE 5
SwissprotQ8H0W31e-110RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2C9WP210.0A0A2C9WP21_MANES; Uncharacterized protein
STRINGcassava4.1_011317m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.28e-96MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]