PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G239000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 757aa    MW: 83717.1 Da    PI: 6.2856
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G239000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.6e-162468147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                         r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Manes.01G239000.1.p 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.13E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.3E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-82464IPR009057Homeodomain-like
PfamPF002493.1E-132467IPR001005SANT/Myb domain
CDDcd001671.46E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
MDIYSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAVAKG VPIRQALDID IPPPRPKRKP SNPYPRKTGV CRTPLQVALK  120
DRELSDSVSL PHYKQALDLE KEPLPEKPDE DEKQTNSKEN QEDNCSEVFT LLPEIHCPSV  180
CSANKNSVPT TEALRNSCSF REFVPTLKEV VNQDGNNESY VTIELQGNQK LDKSDVKQTV  240
QDNGTNRAAK LESCPFHEKL VQGKNSNEFN NALPIDEMEA MQNYPRHVPV HVLDGSLGTC  300
VQTPPSDVSF QESIRQPAEV HGHPNLYSNQ APSTTTEHQS NGPRSSTHQL LQTYPPPFTP  360
THHNQDDFRS FLHISSTFSS LIASTLLQNP AAHAAASFAA TFWPYPNVET SADSPPCAQG  420
GFPSRQMHSA PSMAAIAAAT VAAATAWWAA HGVLPLCAPL HSAFTCSPPA TAVPSVDADQ  480
VPAAKTECKE TTLKNPPLED QQLDLEHSEA LQAQNSASKE SGCTKQNSVS KATDREMTVT  540
APEIDELGKL KNRKQVDRSS CGSNTSSSSE VETDALEKLE KDKEESKEAD TNHLVTEFSN  600
RRSRSSSNLS DLWKEVSEEG RMAFQALFSR EVLPQSFSPP HDLKNEAHQK VNVEDEQRTD  660
GKDGAALLLN LNSKTWGCCN SNHESDISLL PRCEYSGEDG LLTIGLGHGK LKARRTGFKP  720
YKRCSVEAKE NRVVTASSQG EEKSPKRIRM EGEASV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.01G239000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021611101.10.0protein LHY-like isoform X2
TrEMBLA0A251LUQ00.0A0A251LUQ0_MANES; Uncharacterized protein
STRINGcassava4.1_027920m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.31e-103MYB_related family protein