PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G179500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SRS
Protein Properties Length: 360aa    MW: 37221.8 Da    PI: 8.5005
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G179500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702218.61.4e-671392983153
               DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                          sgt++CqdCGnqakkdC+h+RCRtCCksrg+dC+thvkstWvpaa+rrerq ++aaa   a +s +++  k++r   +++++++s+t++s
  Manes.01G179500.1.p 139 SGTTTCQDCGNQAKKDCSHRRCRTCCKSRGYDCTTHVKSTWVPAARRRERQLMAAAAGGGAGSSGSTSGVKKPRLI-NSQTTTTSHTSTS 227
                          7899***********************************************9999999999999999999999986.788899999**** PP

               DUF702  93 saeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                          +++++++++tss          lP +v+++avf+cvrv++vd ge+e+aYq++v+igGhvfkG+LydqG+e
  Manes.01G179500.1.p 228 NTTPPRSFDTSSshqdasfkdaLPGKVRAPAVFKCVRVTAVDGGEDEYAYQAVVKIGGHVFKGFLYDQGVE 298
                          **********999********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.0E-61141298IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-26143185IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.1E-29250297IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGMFVVAPAA SFNHHHHHHQ HQHLHQHESS INLSDPINGP NAATTALGVG MGVGVIPLLT  60
AAPCLSPQNM DDQDLLNNGR NKISGIQFWQ NQTSNHHSQY NLKKTSASIL DHNNSSGNLL  120
QSGNNTSSAG GIGGNSASSG TTTCQDCGNQ AKKDCSHRRC RTCCKSRGYD CTTHVKSTWV  180
PAARRRERQL MAAAAGGGAG SSGSTSGVKK PRLINSQTTT TSHTSTSNTT PPRSFDTSSS  240
HQDASFKDAL PGKVRAPAVF KCVRVTAVDG GEDEYAYQAV VKIGGHVFKG FLYDQGVEGR  300
DGFPNISELH LGGGSSSGGG GDGGGRNGAS SSPIIDPTDV YGASGGGLLG GSSYGNPIN*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18835563}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.01G179500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269|PubMed:18835563}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021634050.10.0protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK91e-83LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A2C9WM920.0A0A2C9WM92_MANES; Uncharacterized protein
STRINGcassava4.1_010457m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.24e-71Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Estornell LH,Landberg K,Cierlik I,Sundberg E
    SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 150
    [PMID:29491878]