PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G141900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 26008.6 Da    PI: 9.0687
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G141900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF946.8e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvt+skRrngi+KKA+EL vLCda+v++i+fs+tgk++e++s
  Manes.01G141900.1.p  9 KRIENSTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSNTGKFHEFIS 59
                         79***********************************************86 PP

2K-box85.21.4e-2871169199
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          yqk+ g +l+++++e++q++l kL++ +++L+r +R+++GedL++ s+ eL+ Le+++ ++l+ +R++K++++++q+e+ +kk ++l+e+
  Manes.01G141900.1.p  71 YQKALGIDLWSTHYERMQEHLGKLREINNKLRRDIRQRMGEDLNDVSILELRDLEERMASALEFVRDRKYHVIKTQTETCRKKVRNLEER 160
                          78899999********************************************************************************** PP

                K-box  91 nkaLrkkle 99 
                          + +L  ++e
  Manes.01G141900.1.p 161 HGDLLLEFE 169
                          *99987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.8161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-37294IPR002100Transcription factor, MADS-box
CDDcd002652.33E-39280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-1982167IPR002487Transcription factor, K-box
PROSITE profilePS5129714.59184174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT YSKRRNGIFK KAQELTVLCD AKVSLIMFSN TGKFHEFISP  60
TITTKKMFDQ YQKALGIDLW STHYERMQEH LGKLREINNK LRRDIRQRMG EDLNDVSILE  120
LRDLEERMAS ALEFVRDRKY HVIKTQTETC RKKVRNLEER HGDLLLEFEA KCEDLQYGLV  180
ENEGDYESAI TIANGASNLY AFRLQHGHPT ANGGGFGSHE LRLA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078388.11e-133PREDICTED: floral homeotic protein DEFICIENS-like
SwissprotP237069e-98DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLF6GWR11e-130F6GWR1_VITVI; Putative uncharacterized protein
TrEMBLQ003J21e-131Q003J2_VITVI; Flowering-related B-class MADS-box protein
STRINGVIT_04s0023g02820.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27353375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-74MIKC_MADS family protein