PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G128500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 276aa    MW: 31732.8 Da    PI: 9.4731
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G128500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.17.5e-3158107150
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fs++g+lyey+
  Manes.01G128500.1.p  58 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYA 107
                          79***********************************************8 PP

2K-box106.53.1e-351272225100
                K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          +  s++e +++ +qqe++kL+++i+++q+ +Rh+lGe L++L+lkeL++Le +Lek+++k+RskKne+l+++ie++qk+e elq++n+ L
  Manes.01G128500.1.p 127 NPASASEVNTQFYQQESSKLRRQIREIQNLNRHILGEALSTLTLKELKNLEGRLEKGISKVRSKKNEMLFAEIEYMQKREIELQNDNMFL 216
                          34458999********************************************************************************** PP

                K-box  95 rkklee 100
                          r+k++e
  Manes.01G128500.1.p 217 RAKIAE 222
                          ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.6E-4050109IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.09550110IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-3251123IPR002100Transcription factor, MADS-box
CDDcd002655.12E-4551127No hitNo description
PRINTSPR004041.4E-325272IPR002100Transcription factor, MADS-box
PROSITE patternPS00350052106IPR002100Transcription factor, MADS-box
PfamPF003195.8E-2659106IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-327287IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-3287108IPR002100Transcription factor, MADS-box
PfamPF014862.0E-25135220IPR002487Transcription factor, K-box
PROSITE profilePS5129714.958136226IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MDSEQEITWR NRVLCTCVTI SILNSQLRAE VATTEFHNQE PDQGPSLRKT GRGKIEIKRI  60
ENTTNRQVTF CKRRNGLLKK AYELSVLCDA EIALIVFSTR GRLYEYANNS VRGTIERYKK  120
ANADSSNPAS ASEVNTQFYQ QESSKLRRQI REIQNLNRHI LGEALSTLTL KELKNLEGRL  180
EKGISKVRSK KNEMLFAEIE YMQKREIELQ NDNMFLRAKI AENEREQQQQ TNIMAGGSVY  240
GSAPSQQYDR NFFPVNLLEP NNHYSRPDHT ALQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-2051122172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-2051122172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-2051122172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-2051122172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A3e-2051122172Myocyte-specific enhancer factor 2A
3kov_B3e-2051122172Myocyte-specific enhancer factor 2A
3kov_I3e-2051122172Myocyte-specific enhancer factor 2A
3kov_J3e-2051122172Myocyte-specific enhancer factor 2A
3p57_A3e-2051122172Myocyte-specific enhancer factor 2A
3p57_B3e-2051122172Myocyte-specific enhancer factor 2A
3p57_C3e-2051122172Myocyte-specific enhancer factor 2A
3p57_D3e-2051122172Myocyte-specific enhancer factor 2A
3p57_I3e-2051122172Myocyte-specific enhancer factor 2A
3p57_J3e-2051122172Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012066543.11e-150PREDICTED: agamous-like MADS-box protein AGL1
SwissprotP293811e-122AGL1_ARATH; Agamous-like MADS-box protein AGL1
TrEMBLG8FUQ31e-141G8FUQ3_MANIN; AGAMOUS-like protein
STRINGGLYMA14G03100.11e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68429102
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.11e-117MIKC_MADS family protein