PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G121700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family G2-like
Protein Properties Length: 489aa    MW: 53923.5 Da    PI: 7.2947
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G121700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32285338255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Manes.01G121700.1.p 285 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 338
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-15282338IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28283338IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23285338IPR006447Myb domain, plants
PfamPF002499.3E-7286337IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MPLEEVFVES SSNPLPDLSL HISPPNTSPS SVSYTVNSIN KSDTSFNLLM SRQVGIHKSN  60
NISSMSTSDS HAYSTELSLA HPASALDEET RNRRNFTGAG TEEPPHNPYQ QSHHHHHHHL  120
HHSSANLSNI NHGVSRLDVS DGLRPIKGIP VYHNRSFPFL PSEQSRENKD PKMCFYQMPY  180
PSSSLCSPSV SPHTSSPYYI GGAGGLDPMS MLNSSGPNQS ASAYNRLAPI TRFNGLSMDS  240
FKSHQLHHQV HHHNQYGVGS GEASHGLLRS RFLPKLPTKR SMRAPRMRWT STLHARFVHA  300
VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK TTDKPAASSG QSDGSGEEDI  360
SPMGNGSGDR GLRQFSDQRG PTDGAAVQQE MDYPSAATTL WSNSSSNREI WPLTNSNDMD  420
GYRESTLQSQ SLDGYREAAL QSQQRSGHTI EECNSTRLKG YLGMNLDCKN PSLEFTLGRP  480
DWQGNEHN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.01G121700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021620843.10.0transcription repressor KAN1-like isoform X1
TrEMBLA0A2C9WK710.0A0A2C9WK71_MANES; Uncharacterized protein
STRINGcassava4.1_021469m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-79G2-like family protein