PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G070800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRF
Protein Properties Length: 219aa    MW: 23968.1 Da    PI: 8.9472
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G070800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.61.4e-25143187145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          +aepgrCrRtDGKkWRCs+++l+++k+C+rH+hrgr+rsrk +e+
  Manes.01G070800.1.p 143 EAEPGRCRRTDGKKWRCSKEALPDQKYCDRHMHRGRHRSRKLVEP 187
                          58****************************************997 PP

2QLQ38.24.3e-1472106337
                  QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                          FT  Ql++L  Q l+yKyL ++ PvP +Ll++i+k
  Manes.01G070800.1.p  72 FTILQLHELQLQSLIYKYLESGFPVPYHLLLPIWK 106
                          7888******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.0E-470106IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.33371106IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.5E-1072105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.532143187IPR014977WRC domain
PfamPF088792.5E-21144186IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MREMESQTPP SKIARLASGV GQTGCLNMER HGSSEGSTTG SPPIALGLAL GLDGSSDHRP  60
TPIPGCSKPY GFTILQLHEL QLQSLIYKYL ESGFPVPYHL LLPIWKSVSS SLNSVNDSSL  120
YQLYPSFMGG SFSLHADYRN VMEAEPGRCR RTDGKKWRCS KEALPDQKYC DRHMHRGRHR  180
SRKLVEPSSS QPISATTNLS ISLPISNDPS NGEVGLRP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298083.24e-83hypothetical protein POPTR_0001s08310g
SwissprotQ6AWX77e-40GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLB9GKS45e-83B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.11e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-32growth-regulating factor 2