PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G058700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 679aa    MW: 75967.2 Da    PI: 6.6377
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G058700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.7e-094454821954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Manes.01G058700.1.p 445 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 482
                          554459******************************88 PP

2BELL113.88.8e-37306377172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          e++e+qk+k+kLls+lee+++rY++y++q+++++ssFeavag g+a++Y +lA+ka+SrhFrcL+d i+ qi
  Manes.01G058700.1.p 306 EFMEMQKRKTKLLSMLEELERRYRHYCDQMKAMVSSFEAVAGAGAATVYSALASKAMSRHFRCLRDGIVAQI 377
                          679*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.8E-62242375IPR006563POX domain
PfamPF075262.9E-47248373IPR006563POX domain
PROSITE profilePS5007112.179423486IPR001356Homeobox domain
CDDcd000868.63E-11426487No hitNo description
SMARTSM003895.8E-9426490IPR001356Homeobox domain
SuperFamilySSF466895.99E-17427492IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27429492IPR009057Homeodomain-like
PfamPF059209.2E-18443482IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MAREFCEDKS RNMVSSSSRG FCYSDASSNN PTIQTHLRNQ IQGFETNPEI FNLTTGMEMI  60
GFTRNLQQQQ SESNTAAMWK GFFNKPGTNN SAGGPSSSKT INESTTDFYQ HEFNKPDFPT  120
GISETSNENL VVGPDSSAPW QEHRLLVDDS SLRCVFPCEA NERPSQGLSL SLSSSNPSSI  180
GIQSFELRHT SNHQNHDNPQ EEMRFINSSS RDGFFGKLSA ANIQQQQMMP DGLLAKTANL  240
HHQGQFQIRN SRYLGPAQEI LNEFCSLGTT QTDQPRPKSH KPKEWDDENG NSSSSSSRKQ  300
SLHSLEFMEM QKRKTKLLSM LEELERRYRH YCDQMKAMVS SFEAVAGAGA ATVYSALASK  360
AMSRHFRCLR DGIVAQIHAT KKAMGEKDPV APGTTRGETP RLRIIDQTIR QQRAIQQMTL  420
MESHPWRPQR GLPERSVSVL RAWLFEHFLH PYPSDVDKHI LARQTGLSRS QVSNWFINAR  480
VRLWKPMVEE MYLEETKEQD NNMTSSDGVT DLEDNDGRPL PNPSSTDQKP TPDQLIRINS  540
DCLSSIISNP DRNETSKGSK TFQNHHLHPQ QQSFGAFGAV ELDFSSYNHH TVGGVSYAND  600
HSANQNFNGG VSLTLGLQQH GESGVSLAFS PASQSSLFYP RDHIDDCPPV QYSLLDGEAQ  660
NLPYRNLMGA QLLHDLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15432490563Homeobox protein Meis2
3k2a_B2e-15432490563Homeobox protein Meis2
4xrm_A2e-15432490563Homeobox protein Meis2
4xrm_B2e-15432490563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029331.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-155BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLU5GJA20.0U5GJA2_POPTR; Uncharacterized protein
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-147TALE family protein