PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G041800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRF
Protein Properties Length: 496aa    MW: 52400.9 Da    PI: 6.7804
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G041800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.84.4e-24175217244
                  WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                           +pgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Manes.01G041800.1.p 175 LQPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKPVE 217
                          589*************************************987 PP

2QLQ52.21.8e-18113145234
                  QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                          +FT aQ+ +L++Q+l+yKy++a++PvP++Ll++
  Manes.01G041800.1.p 113 PFTIAQWKELERQALIYKYMMASVPVPSHLLFP 145
                          8*****************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-11112148IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.29113148IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-12113145IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.213174218IPR014977WRC domain
PfamPF088792.3E-20177217IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MATDGFSFVD KVERNSNSSS DCARTVMVDQ YDHYHPFPSC GLGGGGGDGP TRYINRCISS  60
DIYDVVVAGG GGGAPGGAAD GLRTLQPFDI SPSQTAITAF KSPGIMASSM GFPFTIAQWK  120
ELERQALIYK YMMASVPVPS HLLFPNPRNL DSDQAACRSS LGGGLNLKFT NGADLQPGRC  180
RRTDGKKWRC SRDVAPDQKY CERHMHRGRP RSRKPVELQA NTDINNSKKK TRYTPAISAE  240
SPVPAAVGSQ FLGTISHPYL QASDKVANFD ASLSFASAFK EPRSLEWLIK GEPADQQWHH  300
GGEALNLNSY GNFSAGDDQQ SNHSTLFLNG TPRGFIDAWS NGASDDQSET SRNTGSGVSS  360
NGKLSQSSLS LSMGGFNSMD DEKGQIQMGL GLIESDQNRE CSTKSLGLAP ASWTGATPGG  420
PLAEVIQLSS ANTGSQSSPA AENGESGSPP ATAVSSPSGV LQKTLASFSD SSSNSSPVMA  480
SSQKAKSEIG LLWLN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.01G041800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021621936.10.0growth-regulating factor 7
TrEMBLA0A2C9WHK80.0A0A2C9WHK8_MANES; Uncharacterized protein
STRINGcassava4.1_032760m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-39growth-regulating factor 7