PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.01G025600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24669.3 Da    PI: 9.5119
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.01G025600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF978e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+
  Manes.01G025600.1.p  9 KRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSHKGKLFEYST 59
                         79***********************************************96 PP

2K-box111.58.7e-37761742100
                K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                          ++++ ++++ + +e+++ e+++Lk+++e Lqr++Rh++Ged++sLs+keLq+LeqqL+++lk+iR++Kn+l++e+i+elqkkek++qe+n
  Manes.01G025600.1.p  76 AERQLTATDLNSQENWTLEYNRLKAKVELLQRNHRHYMGEDIDSLSMKELQNLEQQLDTALKHIRTRKNQLMYESISELQKKEKAIQEQN 165
                          5667777778889***************************************************************************** PP

                K-box  92 kaLrkklee 100
                          ++L k+++e
  Manes.01G025600.1.p 166 NMLAKQIKE 174
                          ******987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.226161IPR002100Transcription factor, MADS-box
CDDcd002651.90E-42279No hitNo description
SuperFamilySSF554552.35E-35292IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-3085172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.98488178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRGGLLK KAHEISVLCD AEVALIVFSH KGKLFEYSTD  60
SCMEKILERY ERYSYAERQL TATDLNSQEN WTLEYNRLKA KVELLQRNHR HYMGEDIDSL  120
SMKELQNLEQ QLDTALKHIR TRKNQLMYES ISELQKKEKA IQEQNNMLAK QIKENEKAVA  180
QQALWEQHNH GTNMSPFLLQ QPPLPCLNIG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-22185184Myocyte-specific enhancer factor 2B
1tqe_R1e-22185184Myocyte-specific enhancer factor 2B
1tqe_Q1e-22185184Myocyte-specific enhancer factor 2B
1tqe_P1e-22185184Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512051.21e-146PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotP0DI141e-117AP1_BRARP; Floral homeotic protein APETALA 1
SwissprotD7KWY61e-117AP1_ARALL; Floral homeotic protein APETALA 1
TrEMBLA0A067LA081e-136A0A067LA08_JATCU; Uncharacterized protein
STRINGVIT_01s0011g00100.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-111MIKC_MADS family protein