PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000917315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 155aa    MW: 17582.8 Da    PI: 7.9063
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000917315genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.48.4e-1552110563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    ++ +r+++NRe+ArrsR RKk++ieeL+  v++L + N++L ++l +l +  ++  +e+
  MDP0000917315  52 RKLKRMISNRESARRSRMRKKKQIEELQYQVDQLHSTNRQLSEKLIQLLEGNQQILQEN 110
                    5789********************************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1345112IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.81850113IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.8E-1252108No hitNo description
SuperFamilySSF579595.75E-1252103No hitNo description
PfamPF001701.1E-1352110IPR004827Basic-leucine zipper domain
CDDcd147028.56E-1553101No hitNo description
PROSITE patternPS0003605570IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MELKESMPIN PTRFFHISHI HVPTHGFSAN TSSLGNEAAF GEAGERDMNY ERKLKRMISN  60
RESARRSRMR KKKQIEELQY QVDQLHSTNR QLSEKLIQLL EGNQQILQEN AQLKERVSSL  120
QIILADLIAP LRIEGDVTVN TNGNQLTAED SSTP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360914.21e-106basic leucine zipper 43-like
TrEMBLA0A498JSG01e-102A0A498JSG0_MALDO; Uncharacterized protein
STRINGXP_008374962.11e-105(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.12e-35basic leucine-zipper 70