PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000905135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 174aa    MW: 19765.2 Da    PI: 7.8046
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000905135genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.12.5e-1571129563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    ++ +r+++NRe+ArrsR RKk++ieeL+  v++L + N++L ++l +l +  ++  +e+
  MDP0000905135  71 RKLKRMISNRESARRSRMRKKKQIEELQYQVDQLHSTNRQLSEKLIQLLEGNQQILQEN 129
                    5789********************************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-1464131IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-1266124No hitNo description
PROSITE profilePS5021710.81869132IPR004827Basic-leucine zipper domain
PfamPF001701.3E-1371129IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-1271122No hitNo description
CDDcd147022.63E-1672120No hitNo description
PROSITE patternPS0003607489IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEPNESKGTR YLPNHCLPTH PHPDSLPIYP PRFFPVSHIH VPAHDFSPNA SSLSNEAAFN  60
EAGEPDMNYE RKLKRMISNR ESARRSRMRK KKQIEELQYQ VDQLHSTNRQ LSEKLIQLLE  120
GNQQILQENA QLKERVSSLQ IFLADLITPL RNAGDVTVNT SGNQLRAEDS STP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393381.11e-126basic leucine zipper 43-like
TrEMBLM5WVR47e-91M5WVR4_PRUPE; Uncharacterized protein
STRINGXP_008360914.11e-125(Malus domestica)
STRINGXP_008393381.11e-125(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.12e-37basic leucine-zipper 70