PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000898701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 246aa    MW: 27177.5 Da    PI: 7.2364
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000898701genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1301.1e-0988133550
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     r rr   NReA r++R++Kka ++ Lee+vk+L+  N++L  +l+
  MDP0000898701  88 PRRRRPSGNREAVRKYREKKKAHTAYLEEEVKKLQVLNQQLVRKLQ 133
                    57788889*********************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.6E-980151IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.80686133IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.75E-789133No hitNo description
PfamPF077162.0E-1389133IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1189151No hitNo description
CDDcd146864.57E-1296133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDDGEVVTSD HALLPNPNSS STFHGSTYED TFFDEFLKTA RTCTHTHTCN PPGPDAAHTH  60
TCYHTHTQIL SSEDDDGTKN KDHSIPRPRR RRPSGNREAV RKYREKKKAH TAYLEEEVKK  120
LQVLNQQLVR KLQGQAILEA ERLRLRGLLL EFRGKIDTEL GVFPFGNQCN SNTYFEDSQC  180
NLQSSVGAMG LRCQTDLXCF CPPVGSSVQA SIGARGETXV PSGGNCQPAV IDCRANXNEA  240
STQAK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344616.20.0basic leucine zipper 24-like
RefseqXP_028952234.10.0basic leucine zipper 24-like
RefseqXP_028952236.10.0basic leucine zipper 24-like
TrEMBLA0A498KIC01e-180A0A498KIC0_MALDO; Uncharacterized protein
STRINGXP_008344616.10.0(Malus domestica)
STRINGXP_008363297.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.13e-34bZIP family protein