PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000891899
Common NameBZIP9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 205aa    MW: 23421.8 Da    PI: 6.3702
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000891899genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.11.2e-1585135555
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                    ++ rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L+++l++l++ 
  MDP0000891899  85 RKHRRMISNRESARRSRMRKQKHLDELWSQVVRLRNENHSLIDRLNNLSES 135
                    688***************************************998888764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.4E-1681145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.04783146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-1285159No hitNo description
PfamPF001701.3E-1385135IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-1385135No hitNo description
CDDcd147022.73E-1986137No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MLPGEIISGL HYFEPEIPLX NPSDFAFMQN QIPSLHFNTS FNNLSRQIAP PIGHDFTQQS  60
SSLSNNSSTS DDAEEHHHLR VIDERKHRRM ISNRESARRS RMRKQKHLDE LWSQVVRLRN  120
ENHSLIDRLN NLSESHDMVV EENARLKEEA CDLRQMLTNL QIGSPYNINA STFRELEGEV  180
PCNTAHLRAE SSNQSIAASA DLLH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197104RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.243150.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001315947.11e-148basic leucine zipper 43-like
TrEMBLD9ZIR81e-146D9ZIR8_MALDO; BZIP domain class transcription factor
STRINGXP_008389357.11e-147(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.14e-41basic leucine-zipper 42