PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000881409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 279aa    MW: 29466.6 Da    PI: 8.0525
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000881409genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26043.96.9e-14288147100
         DUF260  47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                    k++p++  +++++sl+yeA+ r+ +P+yG+vg+++++++ql+q+++e++l +++
  MDP0000881409  28 KQTPPSSSPTIFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQVAVEAVLKGQP 81 
                    67899999***************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031958.2E-92876IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDANIRKGCS ENAASGLACS GLRARSPKQT PPSSSPTIFR SLLYEACGRI VNPIYGSVGL  60
LWSGSWQLCQ VAVEAVLKGQ PITPITSEAA ANGHGPPLKA YDIRHVSKDE NSAASNDPQK  120
VKTRYRFKRS AVKAKTNKVG SGSXSGCGSG ADESAKPSWT GCSADKFNRS MSHESSLSHQ  180
SEAAANVDGD SKESESMISS ETAEAELFFR AEPESARKRT ESVQDGELAL ELTLGLQPQS  240
RANHVVPVKK RRIEAGFGAV SPADDGACKM ELGLDYVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.51821e-162bud| cell culture| fruit| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342076.21e-167LOB domain-containing protein 41
SwissprotQ9M8864e-60LBD41_ARATH; LOB domain-containing protein 41
TrEMBLA0A498HFS41e-165A0A498HFS4_MALDO; Uncharacterized protein
STRINGXP_008342076.11e-167(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15463499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.11e-51LOB domain-containing protein 41