PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000879799
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 233aa    MW: 25232.4 Da    PI: 6.3336
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000879799genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.63.7e-42771761100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkCa++Cvlapyfp ++p kf ++h++FGasn++kll+++pe++r da+ss+vyeA+ar++dPvyG++g i++lq+q+ +l+a+la+
  MDP0000879799  77 PCAACKILRRKCAEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQEIPESHRADAVSSMVYEANARIHDPVYGCAGAIFQLQKQVGELQAQLAK 172
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  MDP0000879799 173 TQAE 176
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.70976177IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-4277174IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEFDAKTATT TTSTASLPPP FSYSPSSTSS PSTASFPFPN SQHLSNYLSP HASNSNIATN  60
PFPTSPSPPP APVILSPCAA CKILRRKCAE KCVLAPYFPP TEPLKFTIAH RVFGASNIIK  120
LLQEIPESHR ADAVSSMVYE ANARIHDPVY GCAGAIFQLQ KQVGELQAQL AKTQAELVNM  180
QCQQGNLIAL ICMDMXQSKE QAILQQQQSN NIDTSCFLDE NNLGTAWEPL WT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-42691843118LOB family transfactor Ramosa2.1
5ly0_B9e-42691843118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369398.21e-170LOB domain-containing protein 1-like
SwissprotQ9LQR02e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A498KNK61e-109A0A498KNK6_MALDO; Uncharacterized protein
STRINGXP_008369398.11e-170(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-71LOB domain-containing protein 1