PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000869720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family G2-like
Protein Properties Length: 438aa    MW: 47947 Da    PI: 7.4144
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000869720genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like46.48.5e-1526562555
        G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   e+A+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  MDP0000869720 26 EEAVPKKILDLMNVEKLTRENVASHLQKYRL 56
                   57****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-152561IPR009057Homeodomain-like
SuperFamilySSF466896.27E-82660IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-132656IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MSASLTPIYG EAALKSRTLD LPFMGEEAVP KKILDLMNVE KLTRENVASH LQKYRLYLKR  60
ISCVANQQAN MVAALGTSDS SYLRTASMNG VGNYHALTGP AQFHNNGYRS FPPNGMIGRL  120
NTPAGVGLHC LPSSGMFQLG HAQNPSNSIN DQPVMFPGNR NGNMLPAHLE LDQQHSRGST  180
YDAPIYPNSS GFTDGKVTNR SNDPFGLTDN TLLRHTQDSE VGRNHVMLQS SVSMPSLKPE  240
LLPSFLDHRR LNDNWPTAAQ SSAFRSNSFS ARDSFKQPTL LDSRIGMQVP ASTMSNNSGP  300
TINNDLFMGW DEPKQDSPFR PDVMCSSMNN LMPVNDNVAP FDQNLDARSS AFQRNSDFNS  360
IGQPDFLDVE ISTMDAPLKL KQQGYLMDQR KPQGGYVPHN AGSLDELVSS MMKQLLGTLL  420
AHLIAVNILV KGDKAKS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.80440.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008378770.10.0two-component response regulator ARR12-like isoform X2
TrEMBLA0A498HVB00.0A0A498HVB0_MALDO; Two-component response regulator
STRINGXP_008378763.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-32response regulator 12