PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000863909
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 203aa    MW: 23368 Da    PI: 6.1578
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000863909genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.7e-1587145563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++  ++l++ ++  +k+ +e+
  MDP0000863909  87 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRKENHQILEKLNHVSESHEKVLQEN 145
                    689***************************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-1483147IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.64585148IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.37E-1287137No hitNo description
PfamPF001703.4E-1387145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-1187160No hitNo description
CDDcd147021.93E-1788138No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MQPGEVTGIH YLVPSSSSSP YPPFSMSTQS NATAFEFNRF SSPLYNFQYP TSQLQEXNNN  60
PQQPSSFSSN STSDEADEQQ LSLINERKQR RMISNRESAR RSRMRKQKHL DELWSQVVWL  120
RKENHQILEK LNHVSESHEK VLQENAQLKE EXSELRQMLN DLQLHSPYHP SLRDLEDVPC  180
NTAYLRAESS NQSITSSXDL LG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199106RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017179791.21e-121basic leucine zipper 43-like
SwissprotQ9FMC26e-44BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A498HDC01e-143A0A498HDC0_MALDO; Uncharacterized protein
STRINGXP_008341823.11e-143(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-48basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]