PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000861160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 175aa    MW: 19513.8 Da    PI: 6.9306
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000861160genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.51.1e-4371061100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+C++lrr+CakdC++apyfp+++p kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la+
  MDP0000861160   7 PCASCRLLRRRCAKDCIFAPYFPSDDPYKFAIVHKVFGASNVSKMLQELPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFLQNQVSELQMQLAV 102
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MDP0000861160 103 AQAE 106
                    9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1156107IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-437104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGSGSSPCAS CRLLRRRCAK DCIFAPYFPS DDPYKFAIVH KVFGASNVSK MLQELPIHQR  60
GDAVSSLVYE ANARVRDPVY GCVGAISFLQ NQVSELQMQL AVAQAETLCF QMQQDPVAXP  120
TQIDQHHHQH QDHDQKSLLL SNSDFNSIPH QYFSSFASPS NVIQDPLKRE SLWT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.14390.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008354824.11e-127PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW33e-81LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5W0D71e-101M5W0D7_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g07200.t017e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.18e-71LBD family protein