PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000848210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 177aa    MW: 19516.7 Da    PI: 7.4041
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000848210genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.2e-4513111199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el++
  MDP0000848210  13 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVHPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKELDE 108
                    7*********************************************************************************************99 PP

         DUF260  97 lke 99 
                    +++
  MDP0000848210 109 TNA 111
                    876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.84312113IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MASSSTSSYT NSPCAACKFL RRKCMPDCIF APYFPPEEPQ KFANVHKIFG ASNVSKLLNE  60
VHPHQREDAV NSLAYEAEAR MKDPVYGCVG AISVLQRQVI RLQKELDETN ADLVRYASSY  120
NHEILLPTSQ SERSSSSRVR GGGSLGQNSG SYFDPPWNRN AYGDRNYERG GGEGDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-6531171115LOB family transfactor Ramosa2.1
5ly0_B3e-6531171115LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341419.21e-111LOB domain-containing protein 25
RefseqXP_008341420.21e-111LOB domain-containing protein 25
SwissprotQ8L8Q32e-70LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A498HJC51e-112A0A498HJC5_MALDO; Uncharacterized protein
STRINGXP_008341419.11e-130(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.16e-68LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]