PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000814056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GRF
Protein Properties Length: 552aa    MW: 59640.7 Da    PI: 7.9082
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000814056genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.5e-24174217144
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                    d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  MDP0000814056 174 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 217
                    79****************************************98 PP

2QLQ55.91.3e-1981114235
            QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                    +FT+aQ+ +L++Q+++yKy++a++PvP +Ll+++
  MDP0000814056  81 PFTNAQWKELERQAMIYKYMVASLPVPRDLLFPL 114
                    8******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.0E-1080116IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-1381114IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.72381116IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.586174218IPR014977WRC domain
PfamPF088791.7E-20175217IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MMMVHHDNHR RPFPPSDTTP APDAGGPTCN RPPPTYDDVV AASTGTGSSS GGGAVLRNLQ  60
PFDIRTHTCS AGGMTTSFGF PFTNAQWKEL ERQAMIYKYM VASLPVPRDL LFPLTTTPPG  120
TTAASQSPCN PLSFCFRPRE MISAHPFSLS ALLRLCREKS AGGTFNLRLS NSTDPEPGRC  180
KRTDGKKWRC SRDVAPDQKY CERHMHRGRP RSRKHVEVHA TAASKRVRHD INLAPPLPTV  240
SQETVSISNP GNRINKNVCS SRFMGSNLHP YGPSPVFPER DGAKFASFES MNSASANREP  300
RNLDWLMMKG EPVSDAQWHQ LMHSKTELST KIPYFDPNSS VFSNRSEEES FLNLNSYANF  360
NAGEDQQDCG ECNLFLNPDV APLESPLLEE TPRYFIDAWS KAVMDEANPV NNNDNSSAPS  420
SGQLSPSSLT LSMGGYNTIS EEMGQTQMSL GTSGNGMMPR VSTWPASAPG GPLAEVLKPT  480
TSAASNPSSP VTTGTTTNGE LGSPLAVSPP SGVLQKKFVS PSDSSGNSSP TLASSRAKPE  540
IVSLWLNQSK A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376804.10.0growth-regulating factor 4
TrEMBLA0A498JIB10.0A0A498JIB1_MALDO; Uncharacterized protein
STRINGXP_008376804.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-32growth-regulating factor 7