PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000778465
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family SBP
Protein Properties Length: 491aa    MW: 53472.8 Da    PI: 7.8745
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000778465genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.92.6e-42126201277
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    Cqv gC++dls++k+yh+rhkvCevhsk+++v+++g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  MDP0000778465 126 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTAKVIINGIEQRFCQQCSRFHLLGEFDDGKRSCRKRLAGHNERRRKPQ 201
                    **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33121187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.351123200IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.63E-39124203IPR004333Transcription factor, SBP-box
PfamPF031103.8E-31126199IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MGWELKIPCT FMESQGFGEL GNLGLPEMVG KHLQSDSIRD VVSTSMSTPN LFSGEAESFS  60
RISSSIVDSS SRDSSLIDLK LGRLADHKGV HSSKLSKGTP MLSSSESSTP TKRMRVSGVY  120
SQPAYCQVYG CNKDLSSCKD YHKRHKVCEV HSKTAKVIIN GIEQRFCQQC SRFHLLGEFD  180
DGKRSCRKRL AGHNERRRKP QIGSHSGRAE RFPQSFDGGR FEGNMLTTAS FICQEILPSG  240
NLNPEKYGTS DWCRRLKVEG GTHYGPFLGM PVANGHLHSK PVLPSYDIGK QYPPFHENGT  300
NPQNASIFGQ NGSQYPQDAR GLSSGSHSIF HETALGSQNF NVFDTASAVQ GLLGISDSGC  360
ALSLLSSQSQ NSSGYLSGIP IARPLVIPAS HNFPSSGMNS GAGNHLSPMP LSNGCDDTDD  420
FGISDGIFQG SGFVNTKDRL PFQDGATINL LQLSSQLQRV EDQRQSMLVK QENDAFCFTE  480
NHLKSDLQIR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291261991184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.133770.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008346785.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A498JRF10.0A0A498JRF1_MALDO; Uncharacterized protein
STRINGXP_008346785.10.0(Malus domestica)
STRINGXP_008374656.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-46SBP family protein