PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000753870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family M-type_MADS
Protein Properties Length: 362aa    MW: 41651.1 Da    PI: 8.9667
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000753870genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.41.2e-201151343
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                   i n++ r++tf kRr+gi+KKA+E S+LC+++v++ii++++
  MDP0000753870 11 IANERSRKTTFQKRRKGIMKKAYEFSTLCEVDVCMIIYGPK 51
                   89*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.0E-20158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.918151IPR002100Transcription factor, MADS-box
CDDcd002664.62E-24279No hitNo description
SuperFamilySSF554559.42E-22298IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-10323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-191150IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-102338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRGRLNMEL IANERSRKTT FQKRRKGIMK KAYEFSTLCE VDVCMIIYGP KLTDRPPELQ  60
TWPKNPEEVN RIINKYKAST MCKPPKKTFD LSDLLMDRKN KVYADIYRKR KEMYETKYPA  120
WDERINTFSE SQLEALLNAL DXKLESGKRT LLNRKKEAAG HQIXVMKKEA PTLLMGGNXD  180
VGESSSRKHP CNYEEDQNHM SSFSNNXVDH ILQQYPHQPC DQMLQFDNSN VYLSNLLAPN  240
PGPTAMWMLR ESNYSLQFSA GASGSNSXFP VAGNQGNFSD PMMIHSTVEN TNMNMVMVNN  300
NLNPPRSSYM SQQYYDRLMQ PAVPYMQYPV MPASISSHPV QLRASQAKDD QYQDINHYLW  360
S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028953595.10.0agamous-like MADS-box protein AGL14
TrEMBLA0A498HFG80.0A0A498HFG8_MALDO; Uncharacterized protein
STRINGXP_009344134.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-24M-type_MADS family protein