PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000740787
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 518aa    MW: 56473.9 Da    PI: 8.2082
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000740787genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.51.4e-13443496558
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                    +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN++Lk+ +   +ke+++
  MDP0000740787 443 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTRLKQSVVLRRKEIKQ 496
                    69****************************************998888888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-12439503IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.484441496IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-13442496No hitNo description
SuperFamilySSF579592.0E-10443494No hitNo description
CDDcd147074.40E-24443501No hitNo description
PfamPF001705.6E-11443496IPR004827Basic-leucine zipper domain
PROSITE patternPS000360446461IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MSSYGRDEEA CLLPTTTITI IIAVTVFTIT INTMATAITT TITTTATMIV AGILSPLLSL  60
QPTITPTITT IAMVTIVVIT PTIIASNSAT FPQKKTGMWH RTCPATAQQC GVHTRKRTPV  120
KYKSGSGNDS GSYACRLSSL LPFKSPPGDA LCGSIVADHP QSGSDGYDHN GNDNMELDLP  180
LEQQEGLSKD SSHPSMNSTK HNSIFSLTLD EIQCKSGRNF GSMNMDEFLA NIWSVEEDQE  240
PSKGDQDSAN EKDTTFQPKT LSRQGSFCIP TPLCKKTVDE VWSEIDKSRP RFHDPSSSIG  300
SSGPSGPPQR QQTIGEITLE DFLVKAGVVQ ESPSKSKPSE KRVASTPIQL HCGNRFDADF  360
GIGGQVFASA FLNPQNAMEN ELFSGNGYPI GTTYPMFGTQ SMGESFCLSD IEKCHSLPES  420
SSGGGAKNKK RIIDGPPEVV VERRQRRMIK NRESAARSRA RKQAYTVELE AELNQLKEEN  480
TRLKQSVVLR RKEIKQSTRA QKLAEKLRTM RRAVSLP*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtCould participate in abscisic acid-regulated gene expression during seed development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383939.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RYD63e-64AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A498K9440.0A0A498K944_MALDO; Uncharacterized protein
STRINGXP_008383939.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.16e-54bZIP family protein