PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000729328
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WOX
Protein Properties Length: 481aa    MW: 53512.6 Da    PI: 7.5598
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000729328genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.22.4e-17103163257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                    ++R+++++eq+++Le+ F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  MDP0000729328 103 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRVQLqeygQVGDANVFYWFQNRKSRSKH 163
                    89*****************99*************************************995 PP

2Wus_type_Homeobox110.59.4e-36102164264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+ +L+eyG+++d+NVfyWFQNrk+R+++k
      MDP0000729328 102 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRVQLQEYGQVGDANVFYWFQNRKSRSKHK 164
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-1299166IPR009057Homeodomain-like
PROSITE profilePS5007110.31799164IPR001356Homeobox domain
SMARTSM003893.6E-8101168IPR001356Homeobox domain
CDDcd000863.73E-8102164No hitNo description
Gene3DG3DSA:1.10.10.601.2E-6102163IPR009057Homeodomain-like
PfamPF000467.0E-15103163IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MIVEEVFFST DLSTYPSADE AKTRKQGKHH FLSVSLSLPL VVIIIMASSN RHWPSMFKSK  60
PANCSTHHQW QHEINPSLVS NGCHRPSSYS SVGGCEERSP EPKPRWNPKP EQIRILEAIF  120
NSGMVNPPRD EIRKIRVQLQ EYGQVGDANV FYWFQNRKSR SKHKLRNLHN SSRQQQTHHH  180
HTQLPISTPV XAATTLNIIN AAAPSSSSSS SSENHPPKHQ TTRPSPWGSP LMRLQSTLQL  240
LLTNFFQPHH PHHNEVLPES PFFFPVHQAN INPNLTQGFC FPELANVVHV PHHEQTNNDN  300
NNIGPCTNIL LSEIMNHGAI SRKEYHHHQE DQIKAMKNVD HQQHLNYNID ITTTPTTAAA  360
SSTPTVAVPF PVIHNSRGGV GEAGAMAPGG VAKSTVFIND VAFEVGAGPF NVREAFGDDA  420
VLIHSSGQPV LTNEWGLTLH SLHHGGFYYL EGIGNGRVDN LGPSERDDCW GTLYKLDVPR  480
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371433.30.0WUSCHEL-related homeobox 9
TrEMBLA0A498JW060.0A0A498JW06_MALDO; Uncharacterized protein
STRINGXP_008371433.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.19e-63homeobox-3