PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000729316
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family VOZ
Protein Properties Length: 538aa    MW: 59778.8 Da    PI: 6.0739
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000729316genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ434.51.4e-1332614771217
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pppsaflgpkcalwdc+rpaqg +w+ dycssfha+lalneg+pg+ pvlrp+gi+lkdgllfaalsak+qgk vgipecegaatakspwna+e+f
  MDP0000729316 261 PPPSAFLGPKCALWDCPRPAQGLDWWLDYCSSFHAALALNEGPPGMGPVLRPGGIGLKDGLLFAALSAKAQGKGVGIPECEGAATAKSPWNAPEFF 356
                    89********************************************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                    dls+lege irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+aly lelklvd+
  MDP0000729316 357 DLSVLEGEIIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKCDACALYXLELKLVDG 452
                    ************************************************************************************************ PP

            VOZ 193 kksakgkvskdsladlqkklgrlta 217
                    kk++k+k+++ds+adlqk++grl+a
  MDP0000729316 453 KKNSKSKLTNDSVADLQKQMGRLSA 477
                    ***********************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MSLATDPSSH RQDIRATVSY PTMRPTPSLL PEVCRLEIGI KHFEGDYWKG AGVVMKGSKS  60
TCKSASHKLF KDKAKNRVDD LQGMFTDLQF ARKESRSIDA ALLEEQVHQM LREWKAELNE  120
PSSASSFQQQ GGSLGSFSSD ICRLLQLCEE EDDATSPLAA PKSEPNDQNL QVGESLVFHE  180
GFSVNQGQQE HAFPLADQCK SSPSGVRNAV NNLEGANQLD YHQFELHQDF EQSFYPCFHG  240
TALRGEDTLS QASTYLPSIF PPPSAFLGPK CALWDCPRPA QGLDWWLDYC SSFHAALALN  300
EGPPGMGPVL RPGGIGLKDG LLFAALSAKA QGKGVGIPEC EGAATAKSPW NAPEFFDLSV  360
LEGEIIREWL FFDKPRRAFE SGNRKQRSLP DYNGRGWHES RKQVMNEFGG LKRSYYMDPQ  420
PLNHFEWHLY EYEINKCDAC ALYXLELKLV DGKKNSKSKL TNDSVADLQK QMGRLSAEFP  480
SDNKRTVKGR AKVNAKVSVG NVYYAPNRGA TTNGTFDYEI GAPYDYLVDN VNGYYLT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.9500.0bud| fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5310230.0AB531023.1 Malus x domestica MdVOZ1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371423.10.0uncharacterized protein LOC103434841 isoform X1
RefseqXP_008371424.10.0uncharacterized protein LOC103434841 isoform X1
RefseqXP_028957608.10.0uncharacterized protein LOC103434841 isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A498JVE70.0A0A498JVE7_MALDO; Uncharacterized protein
STRINGXP_008371423.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]