PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000706379
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 300aa    MW: 32102.8 Da    PI: 6.7504
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000706379genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95.1e-14218268454
                    XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +++rr++kNRe+A rsR+RK+a++ eLe  v +Le+eN +L  +  e kk
  MDP0000706379 218 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLLRQQAEQKK 268
                    689************************************987654444443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-13212276No hitNo description
SMARTSM003387.7E-13215279IPR004827Basic-leucine zipper domain
PfamPF001703.6E-12217272IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.68217268IPR004827Basic-leucine zipper domain
CDDcd147072.83E-20219268No hitNo description
SuperFamilySSF579593.38E-10219268No hitNo description
PROSITE patternPS000360222237IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MATSSKMAVV STANSDLPRR ESSICSLSTF LADDDDNRHH KHQSMTMDDI LRNIYSSTGT  60
GTGNDMXDNG HHQQLHHHAE ARSVDEVWKE IVAGGAGVGV GVGEEEVGVA EGDGGDQVRG  120
GEGGGGGGGG MEEMTLEDFL TRAGAVREED VSVNAGGVPI GYGQFQVQPP PPPXAAQGQL  180
VYANGTTSAS GGGGGGGGGG RAGKRRAVQE APLDKATQQK QRRMIKNRES AARSRERKQA  240
YTVELESLVT QLEEENARLL RQQAEQKKXR FKQLMENLIP VVEKRRPPHV LRRVHSVHW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.169013e-83fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008365275.21e-166bZIP transcription factor 12-like
TrEMBLA0A498JA880.0A0A498JA88_MALDO; Uncharacterized protein
STRINGXP_008365275.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20283481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-31bZIP family protein