PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000681033
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 190aa    MW: 21205.8 Da    PI: 11.3267
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000681033genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP74.92.4e-23104170470
            TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                        h  +hTkv+g +RRv + a caa++F+L++eLG+  d++tieWL++ a+p+i++ t+ ++ s 
  MDP0000681033 104 NPLEHQGRHTKVNGWGRRVLMLAMCAAQIFQLTQELGHRFDGETIEWLIRHAEPSIIASTDFGTLST 170
                    5567999***************************************************998754444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136917.346108162IPR017887Transcription factor TCP subgroup
PfamPF036344.4E-18110172IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MVEKRRRTKH LKIPQFSGHR KNQSGELARK KVRVGARGPV PSWARGGTCH NDPPASAQTR  60
RPKPDRDPHS HFDFFHHPNS SIXLAFPTIR PLTXGPAQAP KTGNPLEHQG RHTKVNGWGR  120
RVLMLAMCAA QIFQLTQELG HRFDGETIEW LIRHAEPSII ASTDFGTLST EPISTTTMFV  180
SSQMPFIPC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.12e-23TCP family protein