PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000664841
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family M-type_MADS
Protein Properties Length: 357aa    MW: 40928 Da    PI: 7.4545
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000664841genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.81e-161353343
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                   i n+s r+vtf kRrng+lKKA  L +LCd++v+ i++ ++
  MDP0000664841 13 IPNESSRKVTFRKRRNGLLKKAGDLKTLCDVKVCTIVYEKK 53
                   889**********************************9754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-17164IPR002100Transcription factor, MADS-box
CDDcd001208.76E-20263No hitNo description
PROSITE profilePS5006617.801355IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-18583IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-12525IPR002100Transcription factor, MADS-box
PfamPF003191.0E-171358IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-122540IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-124061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MGRRKSKLPL ELIPNESSRK VTFRKRRNGL LKKAGDLKTL CDVKVCTIVY EKKSKGKLST  60
AATFPKEFKD VKEIIDKYKS NSSKVKRVQS LGDFYATQTV QVKKEIGKLR SKICEEKYPA  120
WDDRFNAFSA EQMLDLLRNL ENKIVAAHEM HSTMKESKQI VVQETIPPMA MFQSNQEYSQ  180
MLGLSDQKPS YCSMMNDDWT QFASTSQTNN IQYTPPVIAS NSIXKISTWE HDQIFNDNYI  240
SAAYGNTDEN ATFYNPMQQQ PCMYDSIFSS AAFQQQQQQA VVPSFENPKP IDALPLRTVL  300
YEYDHPLSVT MQPSYLECPN SATSASSSEY DQKFAASHPQ NMFYDDVFYD NLWHFE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017188224.20.0agamous-like MADS-box protein AGL3
TrEMBLA0A498JPP00.0A0A498JPP0_MALDO; Uncharacterized protein
STRINGXP_009365775.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-15M-type_MADS family protein