PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000623166
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 81aa    MW: 9107.45 Da    PI: 10.1705
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000623166genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP53.78.1e-174180342
            TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfd 42
                    +kdrh k++T++g+RdR vRl a++ ++f+d+qd+LG+d
  MDP0000623166 41 DRKDRHIKVCTAKGPRDRCVRLAAHTTIQFYDIQDRLGYD 80
                   59************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-154180IPR005333Transcription factor, TCP
PROSITE profilePS5136920.0174280IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MQDQKWGIQL WGIRSPSSGG GVISTEIVKV VRGSHIVWVT DRKDRHIKVC TAKGPRDRCV  60
RLAAHTTIQF YDIQDRLGYD *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.1486e-63bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5310215e-60AB531021.1 Malus x domestica MdTCP4A mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340343.15e-33PREDICTED: transcription factor TCP4-like
SwissprotQ8LPR59e-23TCP4_ARATH; Transcription factor TCP4
TrEMBLD5MRQ24e-32D5MRQ2_MALDO; MdTCP4A protein
STRINGGLYMA06G34330.17e-22(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2494423
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.35e-24TCP family protein