PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000589558
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family SBP
Protein Properties Length: 454aa    MW: 49482 Da    PI: 8.5404
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000589558genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.51.7e-4299174277
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    Cqv gC++dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  MDP0000589558  99 CQVYGCNKDLSSYKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLGEFDDGKRSCRRRLAGHNERRRKPQ 174
                    **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-3396160IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.4796173IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.15E-3997176IPR004333Transcription factor, SBP-box
PfamPF031108.9E-3299172IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MVGKHLQNDS IRDAVSTSMS TPNLFFGEDE SSSRISSSIV DSSSRDSSLI DLKLGRLADH  60
RDVHSSKLSK GTPMLSSSGS STPPKRMRVL GVYPRPAYCQ VYGCNKDLSS YKDYHKRHKV  120
CEVHSKTAKV IVNGIEQRFC QQCSRFHLLG EFDDGKRSCR RRLAGHNERR RKPQIGSHPG  180
RAGRFPQSFD GGRFEGNMLA TASFICQEIL PTDIPEKHGM GDCCRHVKFE GGTHYRPLSG  240
MPVTNGHLHS KPVFPSYDIG KQYPSFHENG TNPLTASIFG QNGGQYPQDV RGLSSGSHSI  300
FHETALGSQD FNVFNTASAV PGLSGISNSG CARSLLSSQS QNSSSYXSGI PIVRPLVIPA  360
SHKFPSSGMN SGSRSHLSPI LLSNDCDDTN DFGISDGIIQ GSGFANTKDR LPCQDGATID  420
LLQLSSQLQQ VEDQRQSMQA KQENDAFCCL RIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29991721184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.133770.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028948560.10.0squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_028948561.10.0squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A498KQW40.0A0A498KQW4_MALDO; Uncharacterized protein
STRINGXP_009337984.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-46SBP family protein