PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000551496
Common NameHD13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TALE
Protein Properties Length: 289aa    MW: 32866.8 Da    PI: 6.7995
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000551496genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.67.9e-072392702354
                    SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    +yp+++++++L +++gL+ +q+ +WF N+R +
  MDP0000551496 239 PYPTEDDKAKLVEETGLQLKQINNWFINQRKR 270
                    8*****************************87 PP

2ELK25.53e-09191212122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK +L++++++++ ++++E++
  MDP0000551496 191 ELKIELKQGFKSRIEDVREEIL 212
                    9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.0E-192367IPR005540KNOX1
PfamPF037901.2E-172566IPR005540KNOX1
SMARTSM012561.1E-2380135IPR005541KNOX2
PfamPF037911.9E-1783134IPR005541KNOX2
PROSITE profilePS512139.132191211IPR005539ELK domain
PROSITE profilePS5007110.916211274IPR001356Homeobox domain
SMARTSM003891.4E-7213278IPR001356Homeobox domain
SuperFamilySSF466893.08E-14213278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-23218276IPR009057Homeodomain-like
CDDcd000862.60E-9229275No hitNo description
PfamPF059209.6E-18231270IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MQESGLGMMI GGGGDGHHDQ HNRQLKAEIA THPLYEQLLS AHVSCLRVAT PIDQLPLIDA  60
QLSQSHHLLR SYASQPQHAQ SVSPHERQEL DNFLAQYLIV LCSFKEHLQQ HVRVHAVEAV  120
MACREIESNL QALTGVSLGE VSGATMSDDE DDMPMDFTMD QSSGEGHDMM GFGPLLPTES  180
ERSLMERVRQ ELKIELKQGF KSRIEDVREE ILRKRRAGKL PGDTTTVXKN WWQQHSKWPY  240
PTEDDKAKLV EETGLQLKQI NNWFINQRKR NWHSNSQSVT SLKSKRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267287RKRNWHSNSQSVTSLKSKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.153940.0leaf
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ0381320.0JQ038132.1 Prunus persica cultivar Chiripa KNOPE7 (KNOPE7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280775.10.0homeobox protein HD1-like
SwissprotQ9FPQ81e-170KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLD9ZJ070.0D9ZJ07_MALDO; HD domain class transcription factor
STRINGXP_008381929.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-169KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]