PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000527802
Common NameHSF6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 295aa    MW: 32734.8 Da    PI: 8.7631
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000527802genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind116.51.6e-36101002101
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSEEEEESXXXXXXXXXXXXX CS
   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiweFkhksFkkgkkelleki 97 
                    Fl+k+y +++d++l+++isw+e+g++fvv+++ +fa+++LpkyFkh+nf+SFvRQLn+YgF+k+  ++         weF++++F++g+kell++i
  MDP0000527802  10 FLTKTYLLVDDPSLDDVISWNESGTTFVVWKTXDFARDLLPKYFKHNNFSSFVRQLNTYGFRKTVPDK---------WEFANENFQRGQKELLSEI 96 
                    9***************************************************************9999.........******************* PP

                    XXXX CS
   HSF_DNA-bind  98 krkk 101
                    +r+k
  MDP0000527802  97 RRRK 100
                    **98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.104.9E-38393IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.0E-60699IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467854.72E-34799IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004474.5E-321099IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.0E-201033IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.0E-204860IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.0E-206173IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAQRSVPAPF LTKTYLLVDD PSLDDVISWN ESGTTFVVWK TXDFARDLLP KYFKHNNFSS  60
FVRQLNTYGF RKTVPDKWEF ANENFQRGQK ELLSEIRRRK PVTSTAAQAA LDEKSGGPST  120
PSNSGEELAS TSTSSPDSKN PGSVETATLS QVVNLSDENK KLKRENENLN SELAQTKKQC  180
NELVGFLVKY VKMGPEQINR IIGRGSYGPT CDDFEXNXRG LGLNMDGGDD DEEEKEGLKL  240
FGVWVKGDEK MKGKKTGRDE KLGVSGISGV PRTKRMKGGV DFHXPMMRSG KVCN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A3e-26510616125Heat shock factor protein 1
5d5u_B4e-2659925129Heat shock factor protein 1
5d5v_B4e-2659925129Heat shock factor protein 1
5d5v_D4e-2659925129Heat shock factor protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.142300.0cell culture| fruit| leaf| root| stem
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001315657.10.0heat shock factor protein HSF24
SwissprotP223351e-100HSF24_SOLPE; Heat shock factor protein HSF24
TrEMBLA0A498KPE60.0A0A498KPE6_MALDO; Uncharacterized protein
STRINGXP_008340075.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71143247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36990.12e-78heat shock factor 4
Publications ? help Back to Top
  1. Scharf KD, et al.
    Three tomato genes code for heat stress transcription factors with a region of remarkable homology to the DNA-binding domain of the yeast HSF.
    EMBO J., 1990. 9(13): p. 4495-501
    [PMID:2148291]