PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000498229
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 241aa    MW: 27504.6 Da    PI: 7.8728
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000498229genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind83.53e-26138205269
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SS CS
   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdee 69 
                    Fl+k+y++++d++ ++++sw+e+g+sfvv+d++efak++Lp yFkh+nf+SFvRQLn+Y  + ++  e
  MDP0000498229 138 FLTKTYDLVDDPSSNHMVSWTESGSSFVVWDPTEFAKEMLPMYFKHNNFSSFVRQLNTYIVSLIEPIE 205
                    9**********************************************************766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004151.7E-29134228IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467857.82E-25134207IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.106.3E-28135239IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.7E-15138161IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004474.1E-22138200IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-15176188IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-15189201IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MVAVGRDGGG WWRSHCSRCR RREEINQREK QEGEKQNREG ERVIYGSQLY GLLHXYTIGD  60
EXIGVNFLGT TIIGRVEMDL ETXSSSCRXV WLGXGCGSRT RQMTEWVYWR ATCSSSGXER  120
LWIMEGSQGG SGGAPAPFLT KTYDLVDDPS SNHMVSWTES GSSFVVWDPT EFAKEMLPMY  180
FKHNNFSSFV RQLNTYIVSL IEPIEKEVVP PQKLAGSIES KWKNVWRRED LNMAKTMKRL  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A5e-191292061288Heat shock factor protein 1
5d5u_B6e-191292062197Heat shock factor protein 1
5d5v_B6e-191292062197Heat shock factor protein 1
5d5v_D6e-191292062197Heat shock factor protein 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G63350.12e-26HSF family protein