PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000491277
Common NameHD3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 826aa    MW: 89687.4 Da    PI: 6.4048
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000491277genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.2e-21120175156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  MDP0000491277 120 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 175
                    688999***********************************************999 PP

2START205.22.6e-643275501205
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ +ep+W +s     e +n +e++++f++  +     + +ea+r+sg v+ ++ +lve+l+d++ +W e+++    + +t++
  MDP0000491277 327 ELALAAMDELVKMAQTDEPLWLRSLeggrEVLNHEEYMRNFTPCIGlkpngFVSEASRESGTVIINSLTLVETLMDSN-RWLEMFPgvlaRTSTTD 421
                    5899************************9*************99989*******************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++ +  + ++ +++lpSg+++++++ng+skvtwveh+++
  MDP0000491277 422 VISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDAIRDTTGVPTFMNCRRLPSGCVVQDMPNGYSKVTWVEHAEY 517
                    ***********************************************************999********************************** PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqce 205
                    +++++h l+r+l++sg+ +ga++wvatlqrq e
  MDP0000491277 518 DESQVHHLYRPLLSSGMGFGAQRWVATLQRQSE 550
                    ******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-21101177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-22105177IPR009057Homeodomain-like
PROSITE profilePS5007118.058117177IPR001356Homeobox domain
SMARTSM003893.6E-19118181IPR001356Homeobox domain
CDDcd000861.19E-19120177No hitNo description
PfamPF000468.1E-19120175IPR001356Homeobox domain
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PROSITE profilePS5084842.295318554IPR002913START domain
SuperFamilySSF559618.63E-33319550No hitNo description
CDDcd088752.67E-123322550No hitNo description
SMARTSM002341.1E-47327551IPR002913START domain
PfamPF018524.7E-56327550IPR002913START domain
SuperFamilySSF559614.3E-22579748No hitNo description
SuperFamilySSF559614.3E-22778818No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MSFGGFLDNS TGSGVGARIV ADIPYTNNSN NMPSSAIAQP RLVTQSLTKS MFNSPGLSLA  60
LQTNVDGQGD VTRVAENYEA NNGGRRSREE EHESRSGSDN MDGASGDDQD AADNHHPRKK  120
KRYHRHTPQQ IQELEALFKE CPHPDEKQRL ELSRRLNLET RQVKFWFQNR RTQMKTQLER  180
HENSLLRQEN DKLRAENMSI REAMRNPICS NCGGPAIIGD ISLEEQHLRI ENARLKDDLD  240
RVCALAGKFL GRPISSLAAS MGPPLPSSTL ELGVGSNGFG GMSNVATSMS MGNDFGGGIG  300
SAMSVVSHGR PSVTGLDRSM ERSIFLELAL AAMDELVKMA QTDEPLWLRS LEGGREVLNH  360
EEYMRNFTPC IGLKPNGFVS EASRESGTVI INSLTLVETL MDSNRWLEMF PGVLARTSTT  420
DVISSGMGGT RNGALQLMHA ELQVLSPLVP VREVNFLRFC KQHAEGVWAV VDVSVDAIRD  480
TTGVPTFMNC RRLPSGCVVQ DMPNGYSKVT WVEHAEYDES QVHHLYRPLL SSGMGFGAQR  540
WVATLQRQSE CQAILMSSCV TSRDHTAITA SGRRSMLKLA QRMTDNFCAG VCASTVHKWT  600
KLNAGNVDED VRVMTRESLD DPGEPPGVVL SAATSVWLPV SPQRLFDFLR DERLRSEWDI  660
LSNGGPMQEM AHIAKGQDPG NCVSLLRARA NANQGSMLIL QETCIDAAGS LVVYAPVDIP  720
AMHVVMNGGD SAYVALLPSG FAIVPDGPGS RGPMFGKGGS HGSGNSGGGV DDGGHRVSGS  780
LLTMTFQILV NSLPTAKLTV ESVETVNHLI SCTVQKIKAA LHCES*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.29280.0bud| fruit| leaf| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0679610.0AF067961.1 Malus domestica homeodomain protein (h3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008385703.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A498JIK40.0A0A498JIK4_MALDO; Uncharacterized protein
STRINGXP_008385703.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]