PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000489886
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 381aa    MW: 42645.4 Da    PI: 4.7261
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000489886genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind103.71.6e-32341342102
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSEEEEESXXXXXXXXXXXXX CS
   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiweFkhksFkkgkkelleki 97 
                    Fl+k++e++ed++++ ++sw++  nsfvv+d+++f++++L++yFkhsnf+SF+RQLn+Y  ++++  ++ +k +++ weF+++ F  g+++ll++i
  MDP0000489886  34 FLTKTFEMVEDPSTDAIVSWTRARNSFVVWDSQKFSTTLLTRYFKHSNFSSFIRQLNTYACSSTECMQGFRKVDSDRWEFANEGFLGGQRHLLKTI 129
                    9******************************************************************9998889********************** PP

                    XXXXX CS
   HSF_DNA-bind  98 krkks 102
                    kr+++
  MDP0000489886 130 KRRRH 134
                    **975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.4E-3530132IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.5E-3030132IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.6E-5230132IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004473.3E-2834132IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-133457IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-137284IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-138597IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MDGVVVKEEE IVTCTVGSSP RPVEGLHEVG PPPFLTKTFE MVEDPSTDAI VSWTRARNSF  60
VVWDSQKFST TLLTRYFKHS NFSSFIRQLN TYACSSTECM QGFRKVDSDR WEFANEGFLG  120
GQRHLLKTIK RRRHVSQSMQ QEGGGGACVE LGQCGVETEL ERLKRDRNVL MTEIVKLRQQ  180
QHNSREQVMA MKGRLLATEK KQQQMTTFLA KALNSPSFLQ HLVEKNAKNR KLHGIEIGRK  240
RRLAASPGLE NLQEAPIIDV EDYSANQDLG ELANMEPDIE NFLSTAALDN KLSSGIKDPN  300
PSLVPTSTTG GHLDSVXETI WEELWSDDLI GGNPEEEVVV VGDESEIEVE VDDLVAEPAD  360
WGKDLQDLLD QMGYQTQPKX *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B1e-213213227129Heat shock factor protein 1
5d5v_B1e-213213227129Heat shock factor protein 1
5d5v_D1e-213213227129Heat shock factor protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125131LKTIKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.27811e-155bud| leaf| root
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017189116.20.0heat shock factor protein HSF30-like isoform X2
SwissprotP411521e-129HSF30_SOLPE; Heat shock factor protein HSF30
TrEMBLA0A498J7G80.0A0A498J7G8_MALDO; Uncharacterized protein
STRINGXP_008377695.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82253143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.11e-114heat shock transcription factor A2
Publications ? help Back to Top
  1. Scharf KD,Rose S,Thierfelder J,Nover L
    Two cDNAs for tomato heat stress transcription factors.
    Plant Physiol., 1993. 102(4): p. 1355-6
    [PMID:8278556]