PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000488746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 341aa    MW: 37372.4 Da    PI: 8.6702
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000488746genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15.1e-10118159445
                    XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                    +++ +r ++NR +A++sR++K +++ e e+k+k+Le++   L
  MDP0000488746 118 SRKLKRIISNRASAQKSRLKKVQYVMEMEKKAKTLESQIAFL 159
                    57889*******************************986655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-9115179IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.071117180IPR004827Basic-leucine zipper domain
PfamPF077165.5E-8117164IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.9E-12119174No hitNo description
SuperFamilySSF579591.56E-10119173No hitNo description
CDDcd147038.35E-15120171No hitNo description
PROSITE patternPS000360122137IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MAPSNVPLAP AGSSQVWNQF YLMNHSSGIG GSSSSYAYAN KPPLQPSSNN PAVANTTNTA  60
SVVAVMDADG KNSGPDSDDD DHADAGNQYK DINKGKIVLV DGVQVRLGGN MDTESLDSRK  120
LKRIISNRAS AQKSRLKKVQ YVMEMEKKAK TLESQIAFLA PQVEFYTHQK QFLQMEQKSL  180
NGKIAAYTND KIQKDAEIEA TKKEVARLRX LLDQKANIQA GANASSRMVN QKDAGLLEQM  240
PTPXFNQSGP GKMSFSNSEK VGESSSEANK LKXVTVAQEE QQNQNQPVGL TTMAGQEPAR  300
XXQSVPQQKD KNKMNSEDGD QEMKDVMNFN EQKQQQERFI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A498K9W60.0A0A498K9W6_MALDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF148181113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-24bZIP family protein