PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000446238
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 124aa    MW: 13390.7 Da    PI: 7.507
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000446238genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26035.13.9e-1110515697
         DUF260 56 damsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                    +++s++yeA+ r+ +P yG+vg++++++++ +q++++++l 
  MDP0000446238 10 SIFKSVLYEACGRIVNPTYGSVGLMWSGSWDQCQAAVDAVLE 51
                   689********************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.0E-61047IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MGHAFITSSS IFKSVLYEAC GRIVNPTYGS VGLMWSGSWD QCQAAVDAVL EGPPITGIDA  60
DALQQNTNPN LDPPHISGDI RYVSTDTNSG XSSRNKARTL EQVEKVHKPA QSPTRFCNRV  120
KHQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356758.13e-49PREDICTED: LOB domain-containing protein 42-like
SwissprotQ9CA306e-25LBD42_ARATH; LOB domain-containing protein 42
TrEMBLA0A498I8Q72e-78A0A498I8Q7_MALDO; Uncharacterized protein
STRINGXP_008360156.11e-79(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15463499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68510.12e-27LOB domain-containing protein 42