PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000388684
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 76aa    MW: 8727.07 Da    PI: 7.523
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000388684genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP59.41.4e-1822681157
            TCP 11 ihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakp 57
                   ++T +g+RdR vRls+++a++++dLq++LG+ ++sk ++WLl +   
  MDP0000388684 22 VCTIRGLRDRHVRLSVPIAIQLYDLQERLGLNQPSKVVDWLLDDDHN 68
                   79****************************************87665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136915.4341373IPR017887Transcription factor TCP subgroup
PfamPF036342.3E-162271IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MFWFGIWERS FGSGSRPEPP LVCTIRGLRD RHVRLSVPIA IQLYDLQERL GLNQPSKVVD  60
WLLDDDHNQV RLLLG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.229875e-57bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5010671e-42KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348175.14e-29PREDICTED: transcription factor TCP13-like
SwissprotQ9S7W51e-20TCP13_ARATH; Transcription factor TCP13
TrEMBLA0A022RZ066e-22A0A022RZ06_ERYGU; Uncharacterized protein
STRINGPOPTR_0015s06980.12e-20(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.16e-22plastid transcription factor 1