PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000386314
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 434aa    MW: 47720.1 Da    PI: 4.9746
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000386314genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.55.9e-13144206163
                    XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    e++ kre+rkq NRe+A rsR RK+ae eeL + +++L +e  aL++++eelk  +++l+ e+
  MDP0000386314 144 ERQMKREKRKQANRESAMRSRSRKQAEYEELVKTCESLNEEKIALQSKMEELKGDSKTLRLEN 206
                    799***************************************************999998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.9E-9140203No hitNo description
PfamPF001703.6E-12144206IPR004827Basic-leucine zipper domain
SMARTSM003381.5E-8144208IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852146209IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.81E-8148198No hitNo description
CDDcd147023.39E-12149195No hitNo description
SuperFamilySSF746509.57E-22279421IPR011013Galactose mutarotase-like domain
Gene3DG3DSA:2.70.98.104.0E-16280354IPR014718Glycoside hydrolase-type carbohydrate-binding
PfamPF012631.2E-8281353IPR008183Aldose 1-/Glucose-6-phosphate 1-epimerase
Gene3DG3DSA:2.70.98.106.2E-16355421IPR014718Glycoside hydrolase-type carbohydrate-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016853Molecular Functionisomerase activity
GO:0030246Molecular Functioncarbohydrate binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MDQDVTKKLK GSDGTAVPVG YDNPKEGDNG NLVLEASKSL EQNIDGLKDG NDGDTKANHL  60
TQRKNGSDSM QSAENDVKVH TQVSPTTEEE VNEISTNDSG YAPPAAGFVG VSLGSPYEKI  120
GVSTAFVASS TGAQLPFGTS VLDERQMKRE KRKQANRESA MRSRSRKQAE YEELVKTCES  180
LNEEKIALQS KMEELKGDSK TLRLENAALR EKLKNAQAVT QGGIVSVKIE VDLDLPNDAK  240
NILSNLGSVS RNDELDREKH ESSTSETKFH QLMESNARTD AAIFKPPKAV RGGIPICFPQ  300
VGTGSLDHNG FARNRIWAID NDPPPLRPND SNGKAYVDLL LKPSDDDMKI WPHSEVRIEG  360
LETLDYLDNL CQKERFTEQG DALTFESEVD RAYLKSSDVI AVFDHEKKKT FTVRKEGLPD  420
VGENHVLFGL VTR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028948736.10.0common plant regulatory factor 1-like
RefseqXP_028948737.10.0common plant regulatory factor 1-like
RefseqXP_028948738.10.0common plant regulatory factor 1-like
RefseqXP_028948739.10.0common plant regulatory factor 1-like
RefseqXP_028948740.10.0common plant regulatory factor 1-like
RefseqXP_028948741.10.0common plant regulatory factor 1-like
TrEMBLA0A498I4J90.0A0A498I4J9_MALDO; Uncharacterized protein
STRINGXP_009336257.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15470810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46270.14e-22G-box binding factor 3