PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000378041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 101aa    MW: 11529.4 Da    PI: 9.9394
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000378041genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.72.1e-123669235
                   XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLeekv 35
                   +++kr  r+++NRe+A+ sRqRK+ ++eeLe+k+
  MDP0000378041 36 EQDKRKARLIRNRESAQLSRQRKQHYVEELEDKM 69
                   789****************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001705.2E-103669IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.17E-93971No hitNo description
Gene3DG3DSA:1.20.5.1701.6E-93969No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MKATWSREVP SIGGSENNNN NNNAASVNVS ASANDEQDKR KARLIRNRES AQLSRQRKQH  60
YVEELEDKMP RRREVGAWDN LVESTFVLEP SHXINFGWSR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231469.14e-16PREDICTED: bZIP transcription factor 17 isoform X1
RefseqXP_008231470.14e-16PREDICTED: bZIP transcription factor 17 isoform X2
RefseqXP_020412481.14e-16bZIP transcription factor 17
TrEMBLA0A251QAU69e-15A0A251QAU6_PRUPE; Uncharacterized protein
TrEMBLM5XQW71e-14M5XQW7_PRUPE; Uncharacterized protein
STRINGXP_008231469.12e-15(Prunus mume)
STRINGEMJ214252e-15(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74873448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.13e-12bZIP family protein