PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000325672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 353aa    MW: 38711.6 Da    PI: 9.5385
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000325672genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.21.9e-1381125147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    MDP0000325672  81 RESWTEQEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 125
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.32E-1675131IPR009057Homeodomain-like
PROSITE profilePS5129414.98676130IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-779131IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-1879128IPR006447Myb domain, plants
SMARTSM007177.9E-1180128IPR001005SANT/Myb domain
PfamPF002493.9E-1181125IPR001005SANT/Myb domain
CDDcd001672.55E-883126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MLSLNPNPAQ GFYLFDPMNT NMGLPGLNPM PPPTTGAASA TAATSTTAAC TSSSAPANAA  60
SMSADDQSKK IRKPYTITKS RESWTEQEHD KFLEALQLFD RDWKKIEAFI GSKTVIQIRS  120
HAQKYFLKVQ KKGTSEHVPP PRPKRKATHP YPQKAPKSAA XVSQVAGPFQ SSSXLLEHGY  180
VYQPDSSIVL GTPVNAATLL SWSYNSVPPV NVXQTIKDEG RLSGPTVTHN SCYSSSNESN  240
PTNWKVSETV DRVDPGQPHR VLPDFAQVYK FIGSVFDPSA ISHLERLRQL DPINFETALL  300
LMRNLSINLT SPEFQDHRKL ITSYAVGSDK TKSDGNCNFS RIGKSENAIL SAX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.166160.0bud| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008354011.20.0protein REVEILLE 3-like
SwissprotC0SVG51e-102RVE5_ARATH; Protein REVEILLE 5
SwissprotQ6R0H01e-103RVE3_ARATH; Protein REVEILLE 3
SwissprotQ8H0W31e-102RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A498KI090.0A0A498KI09_MALDO; Uncharacterized protein
STRINGXP_008343412.10.0(Malus domestica)
STRINGXP_008345636.10.0(Malus domestica)
STRINGXP_008354011.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-101MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]